PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.061660.2
Common NameCsa_5G651640, LOC101210677
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 295aa    MW: 33129.3 Da    PI: 8.5048
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.061660.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed++l+d+++++G g+W+t ++  g+ R++k+c++rw +yl
   Cucsa.061660.2 14 KGAWTKDEDQRLIDYIRLHGEGCWRTLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding57.14.2e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T++Edel+++++ +lG++ W+ Ia +++ gRt++++k++w+++
   Cucsa.061660.2  67 RGNFTEDEDELIIKLHSLLGNK-WSVIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.791961IPR017930Myb domain
SMARTSM007172.5E-131363IPR001005SANT/Myb domain
SuperFamilySSF466894.87E-2913108IPR009057Homeodomain-like
PfamPF002492.0E-151461IPR001005SANT/Myb domain
CDDcd001673.23E-101661No hitNo description
PROSITE profilePS5129427.90862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.6E-2865117IPR009057Homeodomain-like
SMARTSM007173.1E-1766114IPR001005SANT/Myb domain
PfamPF002492.3E-1667111IPR001005SANT/Myb domain
CDDcd001674.23E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKD EDQRLIDYIR LHGEGCWRTL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEDEDELIIK LHSLLGNKWS VIAGRLPGRT DNEIKNYWNT HIKRKLITRG  120
IDPQTHRPLN EPPTTAAALS PRLPYQNHHH HHRRHHHHLT PNDHSSSSSS SLPNIAELPI  180
MKAATNVQSS DPDEEGSGTT TEMDPPLPAA EPTLGVHVKT EVNLELSIGL HPFQAEAVRG  240
SSLGSSAESR LREERRALVR CLCWELGWEK GGECNRNCER TYGWFRASAM GSTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-29141187110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818890.0LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004141649.10.0PREDICTED: transcription repressor MYB6
SwissprotQ388512e-92MYB6_ARATH; Transcription repressor MYB6
TrEMBLA0A0A0KXZ40.0A0A0A0KXZ4_CUCSA; Uncharacterized protein
STRINGPOPTR_0019s11090.18e-94(Populus trichocarpa)
STRINGSolyc06g065100.2.14e-94(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.16e-91myb domain protein 6
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]